ARID1A polyclonal antibody
  • ARID1A polyclonal antibody

ARID1A polyclonal antibody

Ref: AB-PAB30731
ARID1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ARID1A.
Información adicional
Size 100 uL
Gene Name ARID1A
Gene Alias B120|BAF250|BAF250a|BM029|C1orf4|P270|SMARCF1
Gene Description AT rich interactive domain 1A (SWI-like)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ARID1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8289
Iso type IgG

Enviar uma mensagem


ARID1A polyclonal antibody

ARID1A polyclonal antibody