AATF polyclonal antibody
  • AATF polyclonal antibody

AATF polyclonal antibody

Ref: AB-PAB30726
AATF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human AATF.
Información adicional
Size 100 uL
Gene Name AATF
Gene Alias CHE-1|CHE1|DED
Gene Description apoptosis antagonizing transcription factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human AATF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 26574
Iso type IgG

Enviar uma mensagem


AATF polyclonal antibody

AATF polyclonal antibody