GRHL2 polyclonal antibody
  • GRHL2 polyclonal antibody

GRHL2 polyclonal antibody

Ref: AB-PAB30713
GRHL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GRHL2.
Información adicional
Size 100 uL
Gene Name GRHL2
Gene Alias BOM|DFNA28|FLJ11172|FLJ13782|MGC149294|MGC149295|TFCP2L3
Gene Description grainyhead-like 2 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GRHL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 79977
Iso type IgG

Enviar uma mensagem


GRHL2 polyclonal antibody

GRHL2 polyclonal antibody