MEF2B polyclonal antibody
  • MEF2B polyclonal antibody

MEF2B polyclonal antibody

Ref: AB-PAB30701
MEF2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MEF2B.
Información adicional
Size 100 uL
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MEF2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 100271849
Iso type IgG

Enviar uma mensagem


MEF2B polyclonal antibody

MEF2B polyclonal antibody