VCAN polyclonal antibody
  • VCAN polyclonal antibody

VCAN polyclonal antibody

Ref: AB-PAB30700
VCAN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human VCAN.
Información adicional
Size 100 uL
Gene Name VCAN
Gene Alias CSPG2|DKFZp686K06110|ERVR|PG-M|WGN|WGN1
Gene Description versican
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human VCAN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1462
Iso type IgG

Enviar uma mensagem


VCAN polyclonal antibody

VCAN polyclonal antibody