STRN3 polyclonal antibody
  • STRN3 polyclonal antibody

STRN3 polyclonal antibody

Ref: AB-PAB30696
STRN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human STRN3.
Información adicional
Size 100 uL
Gene Name STRN3
Gene Alias SG2NA
Gene Description striatin, calmodulin binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWAEPITFPSGGGKS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human STRN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 29966
Iso type IgG

Enviar uma mensagem


STRN3 polyclonal antibody

STRN3 polyclonal antibody