SOCS7 polyclonal antibody
  • SOCS7 polyclonal antibody

SOCS7 polyclonal antibody

Ref: AB-PAB30692
SOCS7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SOCS7.
Información adicional
Size 100 uL
Gene Name SOCS7
Gene Alias NAP4
Gene Description suppressor of cytokine signaling 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGEQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGELAASAASLTDMGGSAGRELDAGRKPKLTR
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SOCS7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 30837
Iso type IgG

Enviar uma mensagem


SOCS7 polyclonal antibody

SOCS7 polyclonal antibody