DAZAP1 polyclonal antibody
  • DAZAP1 polyclonal antibody

DAZAP1 polyclonal antibody

Ref: AB-PAB30686
DAZAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DAZAP1.
Información adicional
Size 100 uL
Gene Name DAZAP1
Gene Alias MGC19907
Gene Description DAZ associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DAZAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 26528
Iso type IgG

Enviar uma mensagem


DAZAP1 polyclonal antibody

DAZAP1 polyclonal antibody