LIMCH1 polyclonal antibody
  • LIMCH1 polyclonal antibody

LIMCH1 polyclonal antibody

Ref: AB-PAB30683
LIMCH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LIMCH1.
Información adicional
Size 100 uL
Gene Name LIMCH1
Gene Alias DKFZp434I0312|DKFZp686A01247|DKFZp686B2470|DKFZp686G18243|DKFZp686G2094|DKFZp781C1754|DKFZp781I1455|LIMCH1A|LMO7B|MGC72127
Gene Description LIM and calponin homology domains 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq HTEEVKLIVTCNMRAQESEPVEGGLRKVPDLHKDDLAQQRIQGSLAPHREPPSFITLSNITEADLETWERLKVSEKARDGDVQHICASEPSPEIKAETAIRDDFANRKARASKKASSPRQKFVHFGPVTELDQQKW
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human LIMCH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 22998
Iso type IgG

Enviar uma mensagem


LIMCH1 polyclonal antibody

LIMCH1 polyclonal antibody