RARS polyclonal antibody
  • RARS polyclonal antibody

RARS polyclonal antibody

Ref: AB-PAB30672
RARS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RARS.
Información adicional
Size 100 uL
Gene Name RARS
Gene Alias ArgRS|DALRD1|MGC8641
Gene Description arginyl-tRNA synthetase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq VVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEI
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RARS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5917
Iso type IgG

Enviar uma mensagem


RARS polyclonal antibody

RARS polyclonal antibody