GUF1 polyclonal antibody
  • GUF1 polyclonal antibody

GUF1 polyclonal antibody

Ref: AB-PAB30658
GUF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GUF1.
Información adicional
Size 100 uL
Gene Name GUF1
Gene Alias FLJ13220
Gene Description GUF1 GTPase homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VENQIEKVFDIPSDECIKISAKLGTNVESVLQAIIERIPPPKVHRKNPLRALVFDSTFDQYRGVIANVALFDGVVSKGDKIVSAHTQKTYEVNEVGVLNPNEQPTHKLYAGQVGYLIAGMKDVTEAQIGDTLCLHKQPVEPL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GUF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 60558
Iso type IgG

Enviar uma mensagem


GUF1 polyclonal antibody

GUF1 polyclonal antibody