FAIM3 polyclonal antibody
  • FAIM3 polyclonal antibody

FAIM3 polyclonal antibody

Ref: AB-PAB30655
FAIM3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FAIM3.
Información adicional
Size 100 uL
Gene Name FAIM3
Gene Alias TOSO
Gene Description Fas apoptotic inhibitory molecule 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq RGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGRE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FAIM3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9214
Iso type IgG

Enviar uma mensagem


FAIM3 polyclonal antibody

FAIM3 polyclonal antibody