BCAP31 polyclonal antibody
  • BCAP31 polyclonal antibody

BCAP31 polyclonal antibody

Ref: AB-PAB30653
BCAP31 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BCAP31.
Información adicional
Size 100 uL
Gene Name BCAP31
Gene Alias 6C6-AG|BAP31|CDM|DXS1357E
Gene Description B-cell receptor-associated protein 31
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BCAP31.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10134
Iso type IgG

Enviar uma mensagem


BCAP31 polyclonal antibody

BCAP31 polyclonal antibody