NDUFS4 polyclonal antibody
  • NDUFS4 polyclonal antibody

NDUFS4 polyclonal antibody

Ref: AB-PAB30646
NDUFS4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NDUFS4.
Información adicional
Size 100 uL
Gene Name NDUFS4
Gene Alias AQDQ
Gene Description NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq RSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NDUFS4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4724
Iso type IgG

Enviar uma mensagem


NDUFS4 polyclonal antibody

NDUFS4 polyclonal antibody