DNAL4 polyclonal antibody
  • DNAL4 polyclonal antibody

DNAL4 polyclonal antibody

Ref: AB-PAB30638
DNAL4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DNAL4.
Información adicional
Size 100 uL
Gene Name DNAL4
Gene Alias PIG27
Gene Description dynein, axonemal, light chain 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DNAL4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10126
Iso type IgG

Enviar uma mensagem


DNAL4 polyclonal antibody

DNAL4 polyclonal antibody