ATP6AP2 polyclonal antibody
  • ATP6AP2 polyclonal antibody

ATP6AP2 polyclonal antibody

Ref: AB-PAB30616
ATP6AP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ATP6AP2.
Información adicional
Size 100 uL
Gene Name ATP6AP2
Gene Alias APT6M8-9|ATP6IP2|ATP6M8-9|ELDF10|HT028|M8-9|MGC99577|MRXE|MSTP009|XMRE
Gene Description ATPase, H+ transporting, lysosomal accessory protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IHC-P,IF
Immunogen Prot. Seq NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ATP6AP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10159
Iso type IgG

Enviar uma mensagem


ATP6AP2 polyclonal antibody

ATP6AP2 polyclonal antibody