MAP3K9 polyclonal antibody
  • MAP3K9 polyclonal antibody

MAP3K9 polyclonal antibody

Ref: AB-PAB30609
MAP3K9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MAP3K9.
Información adicional
Size 100 uL
Gene Name MAP3K9
Gene Alias MLK1|PRKE1
Gene Description mitogen-activated protein kinase kinase kinase 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq EGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRGG
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MAP3K9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4293
Iso type IgG

Enviar uma mensagem


MAP3K9 polyclonal antibody

MAP3K9 polyclonal antibody