PRKX polyclonal antibody
  • PRKX polyclonal antibody

PRKX polyclonal antibody

Ref: AB-PAB30607
PRKX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PRKX.
Información adicional
Size 100 uL
Gene Name PRKX
Gene Alias PKX1
Gene Description protein kinase, X-linked
Storage Conditions Store at 4ºC for short term storage. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq LDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWD
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 267-342 of human PRKX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5613
Iso type IgG

Enviar uma mensagem


PRKX polyclonal antibody

PRKX polyclonal antibody