PFTK1 polyclonal antibody
  • PFTK1 polyclonal antibody

PFTK1 polyclonal antibody

Ref: AB-PAB30604
PFTK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PFTK1.
Información adicional
Size 100 uL
Gene Name PFTK1
Gene Alias KIAA0834|PFTAIRE1
Gene Description PFTAIRE protein kinase 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 35-158 of human PFTK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5218
Iso type IgG

Enviar uma mensagem


PFTK1 polyclonal antibody

PFTK1 polyclonal antibody