MYH11 polyclonal antibody
  • MYH11 polyclonal antibody

MYH11 polyclonal antibody

Ref: AB-PAB30600
MYH11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MYH11.
Información adicional
Size 100 uL
Gene Name MYH11
Gene Alias AAT4|DKFZp686D10126|DKFZp686D19237|FAA4|FLJ35232|MGC126726|MGC32963|SMHC|SMMHC
Gene Description myosin, heavy chain 11, smooth muscle
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 1324-1411 of human MYH11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4629
Iso type IgG

Enviar uma mensagem


MYH11 polyclonal antibody

MYH11 polyclonal antibody