SLITRK5 polyclonal antibody
  • SLITRK5 polyclonal antibody

SLITRK5 polyclonal antibody

Ref: AB-PAB30597
SLITRK5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SLITRK5.
Información adicional
Size 100 uL
Gene Name SLITRK5
Gene Alias FLJ58374|KIAA0918|LRRC11|bA364G4.2
Gene Description SLIT and NTRK-like family, member 5
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVSTPTPSSIQVPARTSAVTPAVRLNSTGAPASLGAGGGASSVPL
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 552-663 of human SLITRK5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 26050
Iso type IgG

Enviar uma mensagem


SLITRK5 polyclonal antibody

SLITRK5 polyclonal antibody