PTRH2 polyclonal antibody
  • PTRH2 polyclonal antibody

PTRH2 polyclonal antibody

Ref: AB-PAB30595
PTRH2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PTRH2.
Información adicional
Size 100 uL
Gene Name PTRH2
Gene Alias BIT1|CGI-147|FLJ32471|PTH2
Gene Description peptidyl-tRNA hydrolase 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq KSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKL
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 42-178 of human PTRH2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 51651
Iso type IgG

Enviar uma mensagem


PTRH2 polyclonal antibody

PTRH2 polyclonal antibody