NUDT1 polyclonal antibody
  • NUDT1 polyclonal antibody

NUDT1 polyclonal antibody

Ref: AB-PAB30591
NUDT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NUDT1.
Información adicional
Size 100 uL
Gene Name NUDT1
Gene Alias MTH1
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq RWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTL
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 72-191 of human NUDT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4521
Iso type IgG

Enviar uma mensagem


NUDT1 polyclonal antibody

NUDT1 polyclonal antibody