SHOC2 polyclonal antibody
  • SHOC2 polyclonal antibody

SHOC2 polyclonal antibody

Ref: AB-PAB30570
SHOC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SHOC2.
Información adicional
Size 100 uL
Gene Name SHOC2
Gene Alias FLJ60412|KIAA0862|SIAA0862|SOC-2|SOC2|SUR-8|SUR8
Gene Description soc-2 suppressor of clear homolog (C. elegans)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 455-562 of human SHOC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8036
Iso type IgG

Enviar uma mensagem


SHOC2 polyclonal antibody

SHOC2 polyclonal antibody