DAXX polyclonal antibody
  • DAXX polyclonal antibody

DAXX polyclonal antibody

Ref: AB-PAB30562
DAXX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DAXX.
Información adicional
Size 100 uL
Gene Name DAXX
Gene Alias BING2|DAP6|EAP1|MGC126245|MGC126246
Gene Description death-domain associated protein
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 481-626 of human DAXX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1616
Iso type IgG

Enviar uma mensagem


DAXX polyclonal antibody

DAXX polyclonal antibody