SKIL polyclonal antibody
  • SKIL polyclonal antibody

SKIL polyclonal antibody

Ref: AB-PAB30558
SKIL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SKIL.
Información adicional
Size 100 uL
Gene Name SKIL
Gene Alias SNO|SnoA|SnoN
Gene Description SKI-like oncogene
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq SPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQ
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 310-448 of human SKIL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6498
Iso type IgG

Enviar uma mensagem


SKIL polyclonal antibody

SKIL polyclonal antibody