MACC1 polyclonal antibody
  • MACC1 polyclonal antibody

MACC1 polyclonal antibody

Ref: AB-PAB30555
MACC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MACC1.
Información adicional
Size 100 uL
Gene Name MACC1
Gene Alias 7A5|SH3BP4L
Gene Description metastasis associated in colon cancer 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PLLEIMLGNLNTMEALLLEMKIGAEVRKDPFSQVMTEMVCLHSLGKEGPFKVLSNCYIYKDTIQVKLIDLSQVMYLVVAAQAKALPSPAATIWDYIHKTTSIGIYGPKYIHPSF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MACC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 346389
Iso type IgG

Enviar uma mensagem


MACC1 polyclonal antibody

MACC1 polyclonal antibody