NGFRAP1 polyclonal antibody
  • NGFRAP1 polyclonal antibody

NGFRAP1 polyclonal antibody

Ref: AB-PAB30552
NGFRAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human NGFRAP1.
Información adicional
Size 100 uL
Gene Name NGFRAP1
Gene Alias BEX3|Bex|DXS6984E|HGR74|NADE
Gene Description nerve growth factor receptor (TNFRSF16) associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NGFRAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27018
Iso type IgG

Enviar uma mensagem


NGFRAP1 polyclonal antibody

NGFRAP1 polyclonal antibody