ELMO2 polyclonal antibody
  • ELMO2 polyclonal antibody

ELMO2 polyclonal antibody

Ref: AB-PAB30550
ELMO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ELMO2.
Información adicional
Size 100 uL
Gene Name ELMO2
Gene Alias CED-12|CED12|ELMO-2|FLJ11656|KIAA1834
Gene Description engulfment and cell motility 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ELMO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63916
Iso type IgG

Enviar uma mensagem


ELMO2 polyclonal antibody

ELMO2 polyclonal antibody