DES polyclonal antibody
  • DES polyclonal antibody

DES polyclonal antibody

Ref: AB-PAB30549
DES polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human DES.
Información adicional
Size 100 uL
Gene Name DES
Gene Alias CMD1I|CSM1|CSM2|FLJ12025|FLJ39719|FLJ41013|FLJ41793
Gene Description desmin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DES.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1674
Iso type IgG

Enviar uma mensagem


DES polyclonal antibody

DES polyclonal antibody