FAIM2 polyclonal antibody
  • FAIM2 polyclonal antibody

FAIM2 polyclonal antibody

Ref: AB-PAB30548
FAIM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human FAIM2.
Información adicional
Size 100 uL
Gene Name FAIM2
Gene Alias KIAA0950|LFG|NGP35|NMP35|TMBIM2
Gene Description Fas apoptotic inhibitory molecule 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FAIM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23017
Iso type IgG

Enviar uma mensagem


FAIM2 polyclonal antibody

FAIM2 polyclonal antibody