USP4 polyclonal antibody
  • USP4 polyclonal antibody

USP4 polyclonal antibody

Ref: AB-PAB30547
USP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human USP4.
Información adicional
Size 100 uL
Gene Name USP4
Gene Alias MGC149848|MGC149849|UNP|Unph
Gene Description ubiquitin specific peptidase 4 (proto-oncogene)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7375
Iso type IgG

Enviar uma mensagem


USP4 polyclonal antibody

USP4 polyclonal antibody