BAG3 polyclonal antibody
  • BAG3 polyclonal antibody

BAG3 polyclonal antibody

Ref: AB-PAB30546
BAG3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human BAG3.
Información adicional
Size 100 uL
Gene Name BAG3
Gene Alias BAG-3|BIS|CAIR-1|MGC104307
Gene Description BCL2-associated athanogene 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BAG3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9531
Iso type IgG

Enviar uma mensagem


BAG3 polyclonal antibody

BAG3 polyclonal antibody