IL16 polyclonal antibody
  • IL16 polyclonal antibody

IL16 polyclonal antibody

Ref: AB-PAB30544
IL16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human IL16.
Información adicional
Size 100 uL
Gene Name IL16
Gene Alias FLJ16806|FLJ42735|FLJ44234|HsT19289|IL-16|LCF|prIL-16
Gene Description interleukin 16 (lymphocyte chemoattractant factor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IL16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3603
Iso type IgG

Enviar uma mensagem


IL16 polyclonal antibody

IL16 polyclonal antibody