MAPKAPK5 polyclonal antibody
  • MAPKAPK5 polyclonal antibody

MAPKAPK5 polyclonal antibody

Ref: AB-PAB30537
MAPKAPK5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MAPKAPK5.
Información adicional
Size 100 uL
Gene Name MAPKAPK5
Gene Alias PRAK
Gene Description mitogen-activated protein kinase-activated protein kinase 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MAPKAPK5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8550
Iso type IgG

Enviar uma mensagem


MAPKAPK5 polyclonal antibody

MAPKAPK5 polyclonal antibody