TANK polyclonal antibody
  • TANK polyclonal antibody

TANK polyclonal antibody

Ref: AB-PAB30534
TANK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human TANK.
Información adicional
Size 100 uL
Gene Name TANK
Gene Alias I-TRAF|TRAF2
Gene Description TRAF family member-associated NFKB activator
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TANK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10010
Iso type IgG

Enviar uma mensagem


TANK polyclonal antibody

TANK polyclonal antibody