NFKB1 polyclonal antibody
  • NFKB1 polyclonal antibody

NFKB1 polyclonal antibody

Ref: AB-PAB30533
NFKB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human NFKB1.
Información adicional
Size 100 uL
Gene Name NFKB1
Gene Alias DKFZp686C01211|EBP-1|KBF1|MGC54151|NF-kappa-B|NFKB-p105|NFKB-p50|p105|p50
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NFKB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4790
Iso type IgG

Enviar uma mensagem


NFKB1 polyclonal antibody

NFKB1 polyclonal antibody