FOS polyclonal antibody
  • FOS polyclonal antibody

FOS polyclonal antibody

Ref: AB-PAB30529
FOS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human FOS.
Información adicional
Size 100 uL
Gene Name FOS
Gene Alias AP-1|C-FOS
Gene Description v-fos FBJ murine osteosarcoma viral oncogene homolog
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FOS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2353
Iso type IgG

Enviar uma mensagem


FOS polyclonal antibody

FOS polyclonal antibody