CASP6 polyclonal antibody
  • CASP6 polyclonal antibody

CASP6 polyclonal antibody

Ref: AB-PAB30528
CASP6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CASP6.
Información adicional
Size 100 uL
Gene Name CASP6
Gene Alias MCH2
Gene Description caspase 6, apoptosis-related cysteine peptidase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq DVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CASP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 839
Iso type IgG

Enviar uma mensagem


CASP6 polyclonal antibody

CASP6 polyclonal antibody