MAP4K2 polyclonal antibody
  • MAP4K2 polyclonal antibody

MAP4K2 polyclonal antibody

Ref: AB-PAB30525
MAP4K2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MAP4K2.
Información adicional
Size 100 uL
Gene Name MAP4K2
Gene Alias BL44|GCK|RAB8IP
Gene Description mitogen-activated protein kinase kinase kinase kinase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ETDPLNEPWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQRE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MAP4K2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5871
Iso type IgG

Enviar uma mensagem


MAP4K2 polyclonal antibody

MAP4K2 polyclonal antibody