TAOK3 polyclonal antibody
  • TAOK3 polyclonal antibody

TAOK3 polyclonal antibody

Ref: AB-PAB30522
TAOK3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TAOK3.
Información adicional
Size 100 uL
Gene Name TAOK3
Gene Alias DKFZp666H245|DPK|FLJ31808|JIK|MAP3K18
Gene Description TAO kinase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq ESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQSSSVNSMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYRNR
Form Liquid
Recomended Dilution Immunofluorescence (1:100 - 1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 323 - 432 of human TAOK3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 51347
Iso type IgG

Enviar uma mensagem


TAOK3 polyclonal antibody

TAOK3 polyclonal antibody