SETDB1 polyclonal antibody
  • SETDB1 polyclonal antibody

SETDB1 polyclonal antibody

Ref: AB-PAB30521
SETDB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SETDB1.
Información adicional
Size 100 uL
Gene Name SETDB1
Gene Alias ESET|KG1T|KIAA0067|KMT1E
Gene Description SET domain, bifurcated 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRPNMGAVRSKGPVVQYTQD
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 290 - 437 of human SETDB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9869
Iso type IgG

Enviar uma mensagem


SETDB1 polyclonal antibody

SETDB1 polyclonal antibody