OTUD5 polyclonal antibody
  • OTUD5 polyclonal antibody

OTUD5 polyclonal antibody

Ref: AB-PAB30519
OTUD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human OTUD5.
Información adicional
Size 100 uL
Gene Name OTUD5
Gene Alias DKFZp761A052|DUBA|MGC104871
Gene Description OTU domain containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq AAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLD
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 439 - 555 of human OTUD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55593
Iso type IgG

Enviar uma mensagem


OTUD5 polyclonal antibody

OTUD5 polyclonal antibody