DUSP10 polyclonal antibody
  • DUSP10 polyclonal antibody

DUSP10 polyclonal antibody

Ref: AB-PAB30515
DUSP10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DUSP10.
Información adicional
Size 100 uL
Gene Name DUSP10
Gene Alias MKP-5|MKP5
Gene Description dual specificity phosphatase 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 180 - 291 of human DUSP10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11221
Iso type IgG

Enviar uma mensagem


DUSP10 polyclonal antibody

DUSP10 polyclonal antibody