PCTK2 polyclonal antibody
  • PCTK2 polyclonal antibody

PCTK2 polyclonal antibody

Ref: AB-PAB30513
PCTK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PCTK2.
Información adicional
Size 100 uL
Gene Name PCTK2
Gene Alias PCTAIRE2
Gene Description PCTAIRE protein kinase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 6 - 132 of human PCTK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5128
Iso type IgG

Enviar uma mensagem


PCTK2 polyclonal antibody

PCTK2 polyclonal antibody