PFTK2 polyclonal antibody
  • PFTK2 polyclonal antibody

PFTK2 polyclonal antibody

Ref: AB-PAB30511
PFTK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PFTK2.
Información adicional
Size 100 uL
Gene Name PFTK2
Gene Alias ALS2CR7
Gene Description PFTAIRE protein kinase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLASYQKGHHPA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PFTK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 65061
Iso type IgG

Enviar uma mensagem


PFTK2 polyclonal antibody

PFTK2 polyclonal antibody