DCLK2 polyclonal antibody
  • DCLK2 polyclonal antibody

DCLK2 polyclonal antibody

Ref: AB-PAB30510
DCLK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DCLK2.
Información adicional
Size 100 uL
Gene Name DCLK2
Gene Alias DCAMKL2|DCDC3|DCDC3B|DCK2|DKFZp761I032|MGC45428
Gene Description doublecortin-like kinase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGMEPISPVPPSVEEIPVPGEAVPAPTPPESPTPHCPPAAPGGERAG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DCLK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 166614
Iso type IgG

Enviar uma mensagem


DCLK2 polyclonal antibody

DCLK2 polyclonal antibody