USP7 polyclonal antibody
  • USP7 polyclonal antibody

USP7 polyclonal antibody

Ref: AB-PAB30505
USP7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human USP7.
Información adicional
Size 100 uL
Gene Name USP7
Gene Alias HAUSP|TEF1
Gene Description ubiquitin specific peptidase 7 (herpes virus-associated)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWDSK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7874
Iso type IgG

Enviar uma mensagem


USP7 polyclonal antibody

USP7 polyclonal antibody