GAP43 polyclonal antibody
  • GAP43 polyclonal antibody

GAP43 polyclonal antibody

Ref: AB-PAB30502
GAP43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GAP43.
Información adicional
Size 100 uL
Gene Name GAP43
Gene Alias B-50|PP46
Gene Description growth associated protein 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GAP43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2596
Iso type IgG

Enviar uma mensagem


GAP43 polyclonal antibody

GAP43 polyclonal antibody