NEK7 polyclonal antibody
  • NEK7 polyclonal antibody

NEK7 polyclonal antibody

Ref: AB-PAB30501
NEK7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NEK7.
Información adicional
Size 100 uL
Gene Name NEK7
Gene Alias -
Gene Description NIMA (never in mitosis gene a)-related kinase 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVAL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NEK7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 140609
Iso type IgG

Enviar uma mensagem


NEK7 polyclonal antibody

NEK7 polyclonal antibody